PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v0338970.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NF-YA
Protein Properties Length: 309aa    MW: 33956.8 Da    PI: 9.2364
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v0338970.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA99.43.7e-31174230158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      +ep+YVN+KQy++Il+RRq Rakle+++kl +k rkpylheSRh hAl+R+Rg gGrF
  Lj3g3v0338970.2 174 EEPIYVNSKQYHAILRRRQYRAKLEAHNKL-IKDRKPYLHESRHLHALKRARGVGGRF 230
                      69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.3E-36172233IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.233173233IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.2E-26175230IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.6E-23176198IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860178198IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.6E-23207230IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MKCLCEKDPG LCSAHPSSTH VLGGPSWATS SESEVPHSSI SNSLSLKVDV LPQQCHKSKA  60
LSFQFQEQDS SSSQSSGQSY PEVGSAQSGQ ISFQHSSSTG SAFSNAEGKS MGYLVRSSMA  120
SRDFTYPPVL DHSQALAHAA FYYADPCYTG AAYAPQSKLM GTGVRVPLPS DYTEEPIYVN  180
SKQYHAILRR RQYRAKLEAH NKLIKDRKPY LHESRHLHAL KRARGVGGRF LNTKQLEESK  240
LTSPNHGLKF SGSTRLNLSG NVPESNETHH QDSDFRLCSY PSHTGRNMQD YTVDKGGGGA  300
NQRRLSVLM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-22173244172NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ7755281e-36FJ775528.1 Glycine max CCAAT-binding transcription factor family protein (NF-YA1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012571402.11e-139PREDICTED: nuclear transcription factor Y subunit A-3-like
SwissprotQ93ZH21e-46NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLG7IS221e-118G7IS22_MEDTR; CCAAT-binding transcription factor
STRINGGLYMA07G04050.51e-105(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17590.41e-41nuclear factor Y, subunit A8